PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G254900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 296aa    MW: 31716.2 Da    PI: 6.2257
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G254900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.69e-161562148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEd++l d++ ++G g+W++ +++ g++R +k+c++rw +yl
  Sevir.1G254900.1.p 15 KGLWSPEEDQKLRDYILRHGHGCWSALPAKAGLHRNGKSCRLRWINYL 62
                        678*******************************************97 PP

2Myb_DNA-binding54.33.1e-1769113248
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         g +++eE+e    +++ lG++ W++Iar+++ gRt++++k++w++yl
  Sevir.1G254900.1.p  69 GMFSPEEEETVMSLHATLGNK-WSRIARHLP-GRTDNEVKNYWNSYL 113
                         569******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.7541062IPR017930Myb domain
SuperFamilySSF466894.4E-2912109IPR009057Homeodomain-like
SMARTSM007172.3E-121464IPR001005SANT/Myb domain
PfamPF002499.6E-141562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-211669IPR009057Homeodomain-like
CDDcd001671.40E-101862No hitNo description
PROSITE profilePS5129425.02963117IPR017930Myb domain
SMARTSM007173.8E-1467115IPR001005SANT/Myb domain
PfamPF002499.1E-1669113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2570116IPR009057Homeodomain-like
CDDcd001672.70E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MGCKACDKPK PNYRKGLWSP EEDQKLRDYI LRHGHGCWSA LPAKAGLHRN GKSCRLRWIN  60
YLRPGLKHGM FSPEEEETVM SLHATLGNKW SRIARHLPGR TDNEVKNYWN SYLKKRVEGK  120
EAPSTAATSS GADSEDSQCA KPGDGAAQEA PADSGSSEPR ESSSADSSCL TGPPAACRPH  180
APVAPPKVMF ADWLDMDMDC IVGGPVAAAP GLDAAGVVGA SPSTGGDRNH RHHQVMSQGS  240
VQVDGPSGVD DVSLHGFGDT GASCWEFQEH FDSIDQMSTT GFCDLLSMSE YFGLN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-26111183109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0387440.0BT038744.1 Zea mays full-length cDNA clone ZM_BFb0323B03 mRNA, complete cds.
GenBankHQ8587140.0HQ858714.1 Zea mays clone UT1170 MYB transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953256.10.0PREDICTED: myb-related protein Myb4
SwissprotQ9M0K47e-55LAF1_ARATH; Transcription factor LAF1
TrEMBLK3YUK10.0K3YUK1_SETIT; Uncharacterized protein
STRINGSi017947m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.14e-57myb domain protein 19